PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta011253
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 203aa    MW: 22280.5 Da    PI: 5.0084
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-66134PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.57e-225722996
     DUF260 29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
               +f ++hk+FGasn +kll +lp +er d+++s+ yeA+ar++dPvyG+v++il+lq+q+++lk +la 
  Pta011253  5 HFGAIHKVFGASNFSKLLMHLPIQERYDTVASVSYEAQARLQDPVYGCVSHILALQHQVANLKGKLAF 72
               7999**********************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.838177IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-20571IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGTPHFGAIH KVFGASNFSK LLMHLPIQER YDTVASVSYE AQARLQDPVY GCVSHILALQ  60
HQVANLKGKL AFGYAQLAAC SSSDGASLIP EYGYGKQSEM PSLMSNSNSS SPSDQQYLNP  120
WGNLQSIPSE SVAANNYDEE AREDEGSWGS FSVCTKGVIQ YARSTAQETD VFREAERFSE  180
QSHPNNYRDG DLQDLASALL RRS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00210.13e-30LOB domain-containing protein 31